PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr015309.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 317aa    MW: 34042.1 Da    PI: 8.7402
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr015309.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-191257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ l ++v+++G+++W++I++ ++ gR++k+c++rw + 
      Pbr015309.1 12 KGPWSPEEDDSLQKLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57
                     79******************************.***********985 PP

2Myb_DNA-binding55.21.6e-1766108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +++a++++G++ W+tIar ++ gRt++ +k++w++ 
      Pbr015309.1  66 AFTPEEDDMIIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 108
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.661762IPR017930Myb domain
SuperFamilySSF466892.58E-329105IPR009057Homeodomain-like
SMARTSM007171.5E-161160IPR001005SANT/Myb domain
PfamPF002494.3E-191257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-261365IPR009057Homeodomain-like
CDDcd001677.24E-161456No hitNo description
SMARTSM007174.3E-1563111IPR001005SANT/Myb domain
PROSITE profilePS5129421.13364113IPR017930Myb domain
PfamPF002493.3E-1566108IPR001005SANT/Myb domain
CDDcd001672.08E-1266109No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2366112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MAVSRKDMDR IKGPWSPEED DSLQKLVQKH GPRNWSLISK SIPGRSGKSC RLRWCNQLSP  60
QVEHRAFTPE EDDMIIRAHA RFGNKWATIA RLLNGRTDNA IKNHWNSTLK RKCSDGGGVD  120
LNGAYDGHVL HDHEQPPLKR SVSAGSGVPV STGLYMSPGS PSGSDVSDSS AQVMSLSDCH  180
VYRPVARTGG VLPPAETTSS SNNNSSNSEK NDPPTSLSLS LPGVDPEEVS NQVARASWPT  240
QAPAPAPAPA PVSTTSVAVQ NIPVELLAVM QGMIRKEVRN YMAGLEQSGV CFQQAAAGNE  300
GFRNVGVKRI GFSRIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-41111123104C-Myb DNA-Binding Domain
1msf_C2e-41111123104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744610.0DQ074461.1 Malus x domestica MYB6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009372447.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW12e-92MYB44_ARATH; Transcription factor MYB44
TrEMBLX2GHX80.0X2GHX8_9R
STRINGPOPTR_0007s10490.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.15e-92myb domain protein 73